PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004544m
Common NameCARUB_v10004544mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 541aa    MW: 59071.2 Da    PI: 9.408
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004544mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.5e-25226269144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  Carubv10004544m 226 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVE 269
                      79***************************************998 PP

2QLQ53.48.1e-19162198137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT +Q+++L++Q+l+yKy+ an+PvP+ Ll  i+k
  Carubv10004544m 162 GPFTLTQWAELEQQALIYKYITANVPVPSSLLISIKK 198
                      59******************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-11162198IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.5E-13163196IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.381163198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.77226270IPR014977WRC domain
PfamPF088793.5E-21227269IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MDIGVHVLGS VTSNENGSPG QKELKGTKQD RSGFNGDDYL QRSLKLARTT TTRDQEEENL  60
SSSFSAAYSK TMPFHQGIPL IRSASPLSSD SRRQEQMLSF CDKPEALDFS KYVGLDSNSN  120
NKSSPLSPFL PPPSYIRTSG GYGSGGMMMN MSMQGNFTGV KGPFTLTQWA ELEQQALIYK  180
YITANVPVPS SLLISIKKSF YPYGSLPPSS FGWGTFHLGF AGGNMDPEPG RCRRTDGKKW  240
RCSRDAVPDQ KYCERHINRG RHRSRKPVEV QSGQTATATA ASKAVTTPQQ PVVAGNSNKS  300
NSRSSNRSLA IGGQYINPST ESLPNNRVRN PQGVPIYPST VNLQPKEAPV VHQKQRNNRN  360
PFEFGHISSD SLLNPNANTE RTYGSSYVDF SSNQDNHTGN HNHNSWPEEV KSDWTQLSMS  420
IPIASSSPSS SHNNNAQDKT TLSPLRLSRE FDLSIQTEET TFEPAAKKVN TWIPISWGNS  480
LGGPLGEVLN STTNSPTLGS SPTGVLQKST FCSLSNNSSV SSPIAENNRN SGDYFHYTTT  540
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937260.0AB493726.1 Arabidopsis thaliana At4g37740 mRNA for hypothetical protein, partial cds, clone: RAAt4g37740.
GenBankAK1764320.0AK176432.1 Arabidopsis thaliana mRNA for transcription activator (GRL2), complete cds, clone: RAFL24-18-E23.
GenBankAY1026350.0AY102635.1 Arabidopsis thaliana transcription activator (GRF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283492.10.0hypothetical protein CARUB_v10004544mg
SwissprotQ8L8A80.0GRF2_ARATH; Growth-regulating factor 2
TrEMBLR0GVQ50.0R0GVQ5_9BRAS; Uncharacterized protein
STRINGAT4G37740.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.10.0growth-regulating factor 2